Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialanimalsgardenswildflowerinsectsbiodiversitymeadow
Rhododendron Calendulaceum or Flame Azalea from Azalea
Flower Poppy from Red
Europeana Floribunda Rose from Roses
Ragged Robin or Deerhorn Clarkia from Celebrating wildflowers coloring book
Orange Honeysuckle from Celebrating wildflowers coloring book
Bumblebee from Bumblebee
Ladybug from Ladybug
Ladybug from Ladybug
Bumblebee from Woodland animals
Cosmos Scabiosoides from Cosmos
Butterfly from Cartoon animals viii coloring book
Apple Blossom Branch from Apple tree
Bee from Cartoon animals v coloring book
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Swallow Tail Hummingbird from Hummingbirds
Daffodil from Daffodil
Steampunk Bee from Steampunk animals coloring book
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Lavender from Plants ii coloring book
Bee from Cartoon animals coloring book
Bee from Cartoon animals viii coloring book
Chinese Peony from Flowers
Black Raspberry from Celebrating wildflowers coloring book
Common Fruit Bats from Realistic animals coloring book
Bug from Animals
Hibiscus from Realistic flowers
Heliconia Indica from Heliconia
Butterfly from Cartoon animals vii coloring book
Cherokee Rose from Roses
Spring Crocus from Crocus
Hibiscus Flower from Hawaii flower
Pollinators of Alaska from Nps
Orchid Lycaste Aromatica from Orchid
Iris Motif from Iris
Chrysanthemum 1 from Perennial
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Iris Flower Blossom from Iris
Disa Kewensis Orchid from Orchid
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Double Delight Hybrid Tea Rose from Roses
Black Elderberry from Elderberry
Masdevallia Coccinea Orchid from Orchid
Grasshopper on the Flower from Grasshoppers
Renanthera Imschootiana Orchid from Orchid
Hyacinth Flower from Hyacinthus
Saskatoon from Serviceberry
Rabbit Smelling Tulip from Grass
Butterfly from Cartoon animals coloring book
Ladybug from Cartoon animals coloring book
Aquilegia Truncata Red Columbine from Columbine
Schlumbergera Bloom from Cactus
Daffodil Flowers from Daffodil
Viola Adunca or Pale Mountain Violet from Violet
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Cirsium Vulgare or Bull Thistle from Thistle
Clarkia Amoena Farewell to Spring from Godetia
Oriental poppy from Perennial
American Twinflower from Celebrating wildflowers coloring book
Bumblebee from Bumblebee
Bumblebee from Simple objects coloring book
Daisy from Simple objects iv coloring book
Ladybug from Cartoon animals v coloring book
Realistic Sunflowers from Sunflower
Ladybug from Cartoon animals viii coloring book
Realistic Ruby Throated Hummingbird from Hummingbirds
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Heliconia Psittacorum from Heliconia
Burke's Larkspur from Celebrating wildflowers coloring book
Bluebell Bellflower from Bellflower
Scarlet Carnation from Carnation
Butterfly Flies On A Flower from Flowers
Aster or Star Plant from Asters
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Ranunculus Acris from Buttercup
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Cornflower, Blue Bottle from Cornflowers
Hummingbird from Cartoon animals ii coloring book
Bug from Cartoon animals coloring book
Wildflower from Plants ii coloring book
Giant Red Indian Paintbrush from Celebrating wildflowers coloring book
Black Locust from Locust tree
Big-Headed Clover from Celebrating wildflowers coloring book
Yellow Edged Giant Owl Butterfly from Butterfly
Hiker's Gentian Or Explorer's Gentian from Celebrating wildflowers coloring book
Daffodil from Daffodil
Blooming Sunflower from Sunflower
Life Cycle of Monarch Butterfly from Biology
Chrysanthemum Morifolium from Flower garden
Chrysanthemum Carinatum from Realistic flowers
Anemone Coronaria from Anemone
Pink Hibiscus from Realistic flowers
Common Evening Primrose or Evening Star from Primrose
Tropical Vanda Tricolor Orchid from Orchid
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Grasshopper in Garden from Grasshoppers
Grasshopper on Flower from Grasshoppers
Sundowner Rosa Grandiflora from Roses
Sophronitis Cernua Orchid from Orchid
Aster 1 from Asters
201 - 300 of 1,830 Next page
/ 19